PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000804.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 862aa    MW: 95860.4 Da    PI: 7.5823
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000804.1_g00013.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.47e-29573623252
                   RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                               k+i+l+ l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Itr_sc000804.1_g00013.1 573 DKTITLQILQQYFAGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKV 623
                              589**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2557643IPR003035RWP-RK domain
PfamPF020422.0E-25575623IPR003035RWP-RK domain
SuperFamilySSF542779.08E-24773859No hitNo description
Gene3DG3DSA:3.10.20.2401.0E-24775854No hitNo description
SMARTSM006664.8E-26775858IPR000270PB1 domain
PROSITE profilePS5174527.948775858IPR000270PB1 domain
CDDcd064072.04E-40776856No hitNo description
PfamPF005644.2E-19777854IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MDGGLCPSAT LLNVSSSDSF MDLDYMNELL CWVERSEGSD VLFHHSPPTA SYMWPVLEAT  60
NNNGQEERQR ASLLPENLSG FQYRTAISPS GQSRRCLVEG SERGWWVCPK TANSITDRLV  120
RAVEYINEFS RDKNVLIQIW VPVSKGGKCV LTTSGQPFQL NKNCPQLAHY RDISENFQFP  180
AEEDSNESSG LPGRVFLDKL PEWTPDVQFF KKDEYPRVGH AQQFDVRGSL AVPVFEQSGC  240
SCLGVIEVVL TTQKLKYLPQ LESVCKALEA VNLRGSILPN ARNAKACDLT YQAVLGEIHD  300
VFRSACETHR LPLAQTWVPC IQQGKEGCRH SDDNLIHCVS TVDSACYVAD PHVRGFHEAC  360
SEHHLLKGQG LVGRAFMTNQ ACFSADVMSS SKAEYPLAHY AKMFGLQASV AIRLKSVSIC  420
SAEFVLEFFL PRNCISPEEH KRMLTSLSII IQNVCQTLRV VTDQELQQET SGFTFSEEGL  480
KLTRNLPDGP YEEEGLPGNS QQTDCHESRG SVSAFENGPS EVVLKKRCPE LRLQLNECVP  540
GSGLAINRNN RASSACNSRG VAKRGDKKRM KTDKTITLQI LQQYFAGSLK DAAKSIGVCP  600
TTLKRICRQH GIKRWPSRKI KKVGHSLQKI QHVIDSVQGV SGGLQIESFY SSFPELVSPN  660
SGSNQFKNLE SHEQPRQQHE GDSTSPRAAA AAVTPSSSCS QSSSSSQCCS TGRQVFRADL  720
AGIKRVKSAA ELHSSSNELK ALPRCQSHAS LIQRPPSRFL PRTKGGGDCR PREDVLRVKV  780
SFGEEKIRLR VHNTWGYEDL LNEIARRFGM DDSTGLQLKY LDDDSEWVLL TCDADLQECF  840
DVCRSSQNQT IKLTFHRVPQ HC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009759077.10.0PREDICTED: protein NLP4-like
RefseqXP_009759078.10.0PREDICTED: protein NLP4-like
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLA0A0V0IWK30.0A0A0V0IWK3_SOLCH; Uncharacterized protein
TrEMBLK4BVX50.0K4BVX5_SOLLC; Uncharacterized protein
TrEMBLM1ALT30.0M1ALT3_SOLTU; Uncharacterized protein
STRINGSolyc04g082480.2.10.0(Solanum lycopersicum)
STRINGPGSC0003DMT4000256570.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein